SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g11910

Feature Type:gene_model
Chromosome:Gm15
Start:8812638
stop:8815291
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g11910
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G04020AT Annotation by Michelle Graham. TAIR10: fibrillin | chr4:1932161-1933546 FORWARD LENGTH=318 SoyBaseE_val: 2.00E-128ISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0010205GO-bp Annotation by Michelle Graham. GO Biological Process: photoinhibition SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0010287GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastoglobule SoyBaseN/AISS
GO:0010319GO-cc Annotation by Michelle Graham. GO Cellular Compartment: stromule SoyBaseN/AISS
GO:0031977GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid lumen SoyBaseN/AISS
GO:0005198GO-mf Annotation by Michelle Graham. GO Molecular Function: structural molecule activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF04755PFAM PAP fibrillin JGI ISS
UniRef100_I1MFL4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MFL4_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q9ZWQ8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Plastid-lipid-associated protein, chloroplastic n=1 Tax=Citrus unshiu RepID=PAP_CITUN SoyBaseE_val: 1.00E-147ISS

Proteins Associated with Glyma15g11910
LocusGene SymbolProtein Name
PAP plastid-lipid associated protein

Expression Patterns of Glyma15g11910
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g11910
ParalogEvidenceComments
Glyma09g01080 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g11910 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g112500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g11910
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g11910
>Glyma15g11910.1   sequence type=CDS   gene model=Glyma15g11910   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGTCTCTCTCTCACCTCAACAAACTCCTCTGCATGCCCCCGCTCAACTCTTCACCCTCTATTTCGCCACCACGCAGCAGCGTCGGAATTTGGACCAAACCTGTCGGAAGGCCGAGGCTACTGGTGCGTGTCCGAGCGGTCACGAGCGACGACGAGTGGGGGCCGGAGAAGGAGGAGGCGTACGGCGGCGGCGTAGCGGTGGAGGAGAAACCGACGAAGTCGGAGACGGAGACGGAGAAGCTGAAGAAGGCCTTGGTGGATTCGTTTTATGGCACCGATCGTGGACTGAAAGCAACGAGCGAAACGAGAGCGGAGATCGTTGAACTCATCACACAGCTCGAGGCCAAGAACCCTAACCCTGTTCCCACCGACGCCTTGACTCTTCTCAACGGAAAATGGATTCTCGCGTATACATCCTTTGCAGGTTTATTCCCATTGTTGTCAAGTGGAACACTACCATTGGTCAAGGTAGAGGAAATATCCCAGATTATTGACTCGCTGAATTTTACCGTCCAAAACTCTGTTCAGTTCGCTGGTCCTTTGGCCACCACCTCAATTAGTACTAATGCCAAATTTGATGTTCGAAGTCCAAAACGTGTGCAGATAAAGTTTGAGGAAGGCATAATTGGCACTCCACAGCTTACGGACTCATTAGAGATACCGGAAAATGTGGAATTTCTGGGTCAAAAGATTGACCTTACACTTTTCAAAGGCATCCTTACCTCTGTCCAAGACACAGCCACATCGGTAGTGAAAACAATTTCAAGTAGGCCTCCCTTGAAGATCCCAATTTCCAACAGCAATGCTCAGTCCTGGTTACTCACCACATACCTCGACGAAGAATTGCGTATCTCAAGGGGCGATGGTGGCAGTGTGTTTGTTCTTATCAAAGAAGGAAGCTCTCTTTTGACAAGATAA
Predicted protein sequences of Glyma15g11910
>Glyma15g11910.1   sequence type=predicted peptide   gene model=Glyma15g11910   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASLSHLNKLLCMPPLNSSPSISPPRSSVGIWTKPVGRPRLLVRVRAVTSDDEWGPEKEEAYGGGVAVEEKPTKSETETEKLKKALVDSFYGTDRGLKATSETRAEIVELITQLEAKNPNPVPTDALTLLNGKWILAYTSFAGLFPLLSSGTLPLVKVEEISQIIDSLNFTVQNSVQFAGPLATTSISTNAKFDVRSPKRVQIKFEEGIIGTPQLTDSLEIPENVEFLGQKIDLTLFKGILTSVQDTATSVVKTISSRPPLKIPISNSNAQSWLLTTYLDEELRISRGDGGSVFVLIKEGSSLLTR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo